Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 11,016
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  4. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,867
  6. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  7. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  8. Avatar for Window Group 18. Window Group 1 pt. 8,991
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975
  1. Avatar for SKSbell 91. SKSbell Lv 1 2 pts. 11,194
  2. Avatar for Hellcat6 92. Hellcat6 Lv 1 2 pts. 11,178
  3. Avatar for donuts554 93. donuts554 Lv 1 2 pts. 11,177
  4. Avatar for argyrw 94. argyrw Lv 1 2 pts. 11,097
  5. Avatar for zippyc137 95. zippyc137 Lv 1 2 pts. 11,091
  6. Avatar for pascal ochem 96. pascal ochem Lv 1 2 pts. 11,077
  7. Avatar for Beany 97. Beany Lv 1 2 pts. 11,064
  8. Avatar for wosser1 98. wosser1 Lv 1 1 pt. 11,061
  9. Avatar for Todd6485577 99. Todd6485577 Lv 1 1 pt. 11,036
  10. Avatar for Simek 100. Simek Lv 1 1 pt. 11,019

Comments