Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 11,016
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  4. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,867
  6. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  7. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  8. Avatar for Window Group 18. Window Group 1 pt. 8,991
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975
  1. Avatar for nathanmills 101. nathanmills Lv 1 1 pt. 11,016
  2. Avatar for prooh 102. prooh Lv 1 1 pt. 11,000
  3. Avatar for Mohoernchen 103. Mohoernchen Lv 1 1 pt. 10,993
  4. Avatar for Dr.Sillem 104. Dr.Sillem Lv 1 1 pt. 10,978
  5. Avatar for AlkiP0Ps 105. AlkiP0Ps Lv 1 1 pt. 10,978
  6. Avatar for Arne Heessels 106. Arne Heessels Lv 1 1 pt. 10,976
  7. Avatar for rinze 107. rinze Lv 1 1 pt. 10,974
  8. Avatar for REDing 108. REDing Lv 1 1 pt. 10,958
  9. Avatar for Deleted player 109. Deleted player 1 pt. 10,947
  10. Avatar for Savas 110. Savas Lv 1 1 pt. 10,944

Comments