Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 11,016
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  4. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,867
  6. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  7. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  8. Avatar for Window Group 18. Window Group 1 pt. 8,991
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975
  1. Avatar for adriannapowers 131. adriannapowers Lv 1 1 pt. 10,767
  2. Avatar for Jumper2 132. Jumper2 Lv 1 1 pt. 10,767
  3. Avatar for chilifish 133. chilifish Lv 1 1 pt. 10,745
  4. Avatar for irinamakarevitch 134. irinamakarevitch Lv 1 1 pt. 10,743
  5. Avatar for Anatolii_Kozak 135. Anatolii_Kozak Lv 1 1 pt. 10,676
  6. Avatar for astroengisci 136. astroengisci Lv 1 1 pt. 10,670
  7. Avatar for 9racoon 137. 9racoon Lv 1 1 pt. 10,544
  8. Avatar for codaphillips 138. codaphillips Lv 1 1 pt. 10,527
  9. Avatar for deathbat_87 139. deathbat_87 Lv 1 1 pt. 10,421
  10. Avatar for Torrin Stebbins 140. Torrin Stebbins Lv 1 1 pt. 10,353

Comments