Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 11,016
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  4. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,867
  6. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  7. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  8. Avatar for Window Group 18. Window Group 1 pt. 8,991
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 73 pts. 12,043
  2. Avatar for MicElephant 12. MicElephant Lv 1 71 pts. 12,041
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 68 pts. 12,038
  4. Avatar for guineapig 14. guineapig Lv 1 66 pts. 12,036
  5. Avatar for nicobul 15. nicobul Lv 1 64 pts. 12,006
  6. Avatar for mirp 16. mirp Lv 1 62 pts. 12,006
  7. Avatar for BarrySampson 17. BarrySampson Lv 1 60 pts. 11,998
  8. Avatar for aznarog 18. aznarog Lv 1 58 pts. 11,986
  9. Avatar for silent gene 19. silent gene Lv 1 56 pts. 11,978
  10. Avatar for Galaxie 20. Galaxie Lv 1 54 pts. 11,953

Comments