Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  3. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  4. Avatar for Deleted group 15. Deleted group pts. 10,867
  5. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  6. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  7. Avatar for Window Group 18. Window Group 1 pt. 8,991
  8. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975

  1. Avatar for cbwest 31. cbwest Lv 1 36 pts. 11,882
  2. Avatar for drjr 32. drjr Lv 1 35 pts. 11,881
  3. Avatar for GuR0 33. GuR0 Lv 1 33 pts. 11,869
  4. Avatar for BootsMcGraw 34. BootsMcGraw Lv 1 32 pts. 11,838
  5. Avatar for Tygh 35. Tygh Lv 1 31 pts. 11,834
  6. Avatar for Lotus23 36. Lotus23 Lv 1 30 pts. 11,796
  7. Avatar for Norrjane 37. Norrjane Lv 1 28 pts. 11,794
  8. Avatar for equilibria 38. equilibria Lv 1 27 pts. 11,770
  9. Avatar for NeLikomSheet 39. NeLikomSheet Lv 1 26 pts. 11,768
  10. Avatar for tracybutt 40. tracybutt Lv 1 25 pts. 11,767

Comments