Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 11,016
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  4. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,867
  6. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  7. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  8. Avatar for Window Group 18. Window Group 1 pt. 8,991
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975
  1. Avatar for kyoota 51. kyoota Lv 1 16 pts. 11,575
  2. Avatar for alcor29 52. alcor29 Lv 1 15 pts. 11,573
  3. Avatar for ProfVince 53. ProfVince Lv 1 15 pts. 11,561
  4. Avatar for SWR_DMaster 54. SWR_DMaster Lv 1 14 pts. 11,555
  5. Avatar for Trajan464 55. Trajan464 Lv 1 13 pts. 11,549
  6. Avatar for zackallen 56. zackallen Lv 1 13 pts. 11,540
  7. Avatar for ppp6 57. ppp6 Lv 1 12 pts. 11,518
  8. Avatar for Ashrai 58. Ashrai Lv 1 12 pts. 11,488
  9. Avatar for fisherlr777 59. fisherlr777 Lv 1 11 pts. 11,484
  10. Avatar for heather-1 60. heather-1 Lv 1 11 pts. 11,473

Comments