Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for SKSbell 91. SKSbell Lv 1 2 pts. 11,194
  2. Avatar for Hellcat6 92. Hellcat6 Lv 1 2 pts. 11,178
  3. Avatar for donuts554 93. donuts554 Lv 1 2 pts. 11,177
  4. Avatar for argyrw 94. argyrw Lv 1 2 pts. 11,097
  5. Avatar for zippyc137 95. zippyc137 Lv 1 2 pts. 11,091
  6. Avatar for pascal ochem 96. pascal ochem Lv 1 2 pts. 11,077
  7. Avatar for Beany 97. Beany Lv 1 2 pts. 11,064
  8. Avatar for wosser1 98. wosser1 Lv 1 1 pt. 11,061
  9. Avatar for Todd6485577 99. Todd6485577 Lv 1 1 pt. 11,036
  10. Avatar for Simek 100. Simek Lv 1 1 pt. 11,019

Comments