Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for Dane2010 121. Dane2010 Lv 1 1 pt. 10,887
  2. Avatar for BPS_Baldetti_2020 122. BPS_Baldetti_2020 Lv 1 1 pt. 10,867
  3. Avatar for Big..Brain 123. Big..Brain Lv 1 1 pt. 10,846
  4. Avatar for pruneau_44 124. pruneau_44 Lv 1 1 pt. 10,836
  5. Avatar for Altercomp 125. Altercomp Lv 1 1 pt. 10,835
  6. Avatar for winterkonig 126. winterkonig Lv 1 1 pt. 10,823
  7. Avatar for felimare 127. felimare Lv 1 1 pt. 10,786
  8. Avatar for ERVs 128. ERVs Lv 1 1 pt. 10,782
  9. Avatar for illex 129. illex Lv 1 1 pt. 10,781
  10. Avatar for User098123 130. User098123 Lv 1 1 pt. 10,779

Comments