Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for adriannapowers 131. adriannapowers Lv 1 1 pt. 10,767
  2. Avatar for Jumper2 132. Jumper2 Lv 1 1 pt. 10,767
  3. Avatar for chilifish 133. chilifish Lv 1 1 pt. 10,745
  4. Avatar for irinamakarevitch 134. irinamakarevitch Lv 1 1 pt. 10,743
  5. Avatar for Anatolii_Kozak 135. Anatolii_Kozak Lv 1 1 pt. 10,676
  6. Avatar for astroengisci 136. astroengisci Lv 1 1 pt. 10,670
  7. Avatar for 9racoon 137. 9racoon Lv 1 1 pt. 10,544
  8. Avatar for codaphillips 138. codaphillips Lv 1 1 pt. 10,527
  9. Avatar for deathbat_87 139. deathbat_87 Lv 1 1 pt. 10,421
  10. Avatar for Torrin Stebbins 140. Torrin Stebbins Lv 1 1 pt. 10,353

Comments