Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for Guizmoyo 141. Guizmoyo Lv 1 1 pt. 10,297
  2. Avatar for ivalnic 142. ivalnic Lv 1 1 pt. 10,116
  3. Avatar for AKulper 143. AKulper Lv 1 1 pt. 9,966
  4. Avatar for FloSchw 144. FloSchw Lv 1 1 pt. 9,654
  5. Avatar for amyaronm 145. amyaronm Lv 1 1 pt. 9,567
  6. Avatar for Xin Jin 146. Xin Jin Lv 1 1 pt. 9,227
  7. Avatar for jflat06 147. jflat06 Lv 1 1 pt. 8,991
  8. Avatar for joshmiller 148. joshmiller Lv 1 1 pt. 8,975
  9. Avatar for joahyeoun 149. joahyeoun Lv 1 1 pt. 8,949
  10. Avatar for devjosh 150. devjosh Lv 1 1 pt. 8,949

Comments