Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for cbwest 31. cbwest Lv 1 36 pts. 11,882
  2. Avatar for drjr 32. drjr Lv 1 35 pts. 11,881
  3. Avatar for GuR0 33. GuR0 Lv 1 33 pts. 11,869
  4. Avatar for BootsMcGraw 34. BootsMcGraw Lv 1 32 pts. 11,838
  5. Avatar for Tygh 35. Tygh Lv 1 31 pts. 11,834
  6. Avatar for Lotus23 36. Lotus23 Lv 1 30 pts. 11,796
  7. Avatar for Norrjane 37. Norrjane Lv 1 28 pts. 11,794
  8. Avatar for equilibria 38. equilibria Lv 1 27 pts. 11,770
  9. Avatar for NeLikomSheet 39. NeLikomSheet Lv 1 26 pts. 11,768
  10. Avatar for tracybutt 40. tracybutt Lv 1 25 pts. 11,767

Comments