Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 24 pts. 11,741
  2. Avatar for John McLeod 42. John McLeod Lv 1 23 pts. 11,734
  3. Avatar for fpc 43. fpc Lv 1 22 pts. 11,732
  4. Avatar for maithra 44. maithra Lv 1 21 pts. 11,700
  5. Avatar for carsonfb 45. carsonfb Lv 1 21 pts. 11,684
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 20 pts. 11,661
  7. Avatar for phi16 47. phi16 Lv 1 19 pts. 11,613
  8. Avatar for martinzblavy 48. martinzblavy Lv 1 18 pts. 11,604
  9. Avatar for spdenne 49. spdenne Lv 1 17 pts. 11,589
  10. Avatar for Evica 50. Evica Lv 1 17 pts. 11,587

Comments