Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for kyoota 51. kyoota Lv 1 16 pts. 11,575
  2. Avatar for alcor29 52. alcor29 Lv 1 15 pts. 11,573
  3. Avatar for ProfVince 53. ProfVince Lv 1 15 pts. 11,561
  4. Avatar for SWR_DMaster 54. SWR_DMaster Lv 1 14 pts. 11,555
  5. Avatar for Trajan464 55. Trajan464 Lv 1 13 pts. 11,549
  6. Avatar for zackallen 56. zackallen Lv 1 13 pts. 11,540
  7. Avatar for ppp6 57. ppp6 Lv 1 12 pts. 11,518
  8. Avatar for Ashrai 58. Ashrai Lv 1 12 pts. 11,488
  9. Avatar for fisherlr777 59. fisherlr777 Lv 1 11 pts. 11,484
  10. Avatar for heather-1 60. heather-1 Lv 1 11 pts. 11,473

Comments