Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for cjddig 71. cjddig Lv 1 6 pts. 11,387
  2. Avatar for Formula350 72. Formula350 Lv 1 6 pts. 11,379
  3. Avatar for Vinara 73. Vinara Lv 1 6 pts. 11,374
  4. Avatar for xythus 74. xythus Lv 1 5 pts. 11,372
  5. Avatar for Pibeagles1 75. Pibeagles1 Lv 1 5 pts. 11,367
  6. Avatar for kevin everington 76. kevin everington Lv 1 5 pts. 11,363
  7. Avatar for NPrincipi 77. NPrincipi Lv 1 4 pts. 11,356
  8. Avatar for fishercat 78. fishercat Lv 1 4 pts. 11,330
  9. Avatar for rabamino12358 79. rabamino12358 Lv 1 4 pts. 11,310
  10. Avatar for jsfoldingaccount 80. jsfoldingaccount Lv 1 4 pts. 11,307

Comments