Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228

  1. Avatar for ArcherTitou 151. ArcherTitou Lv 1 1 pt. 8,949
  2. Avatar for BPS_Giannetti_2020 152. BPS_Giannetti_2020 Lv 1 1 pt. 8,949
  3. Avatar for Anastase 153. Anastase Lv 1 1 pt. 8,949
  4. Avatar for Qizhou_Huang 154. Qizhou_Huang Lv 1 1 pt. 8,949
  5. Avatar for MarkSmith 155. MarkSmith Lv 1 1 pt. 8,949
  6. Avatar for Keresto 156. Keresto Lv 1 1 pt. 8,949
  7. Avatar for bkoep 157. bkoep Lv 1 1 pt. 8,949
  8. Avatar for artara 158. artara Lv 1 1 pt. 8,949
  9. Avatar for Dmitriy_Egorov 159. Dmitriy_Egorov Lv 1 1 pt. 8,949
  10. Avatar for Study2020 160. Study2020 Lv 1 1 pt. 8,949

Comments