Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for silent gene
    1. silent gene Lv 1
    100 pts. 11,248
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 78 pts. 11,246
  3. Avatar for LociOiling 3. LociOiling Lv 1 60 pts. 11,243
  4. Avatar for mirp 4. mirp Lv 1 45 pts. 11,235
  5. Avatar for ichwilldiesennamen 5. ichwilldiesennamen Lv 1 33 pts. 11,229
  6. Avatar for kyoota 6. kyoota Lv 1 24 pts. 11,222
  7. Avatar for Deleted player 7. Deleted player 17 pts. 11,214
  8. Avatar for Galaxie 8. Galaxie Lv 1 12 pts. 11,175
  9. Avatar for phi16 9. phi16 Lv 1 8 pts. 11,162
  10. Avatar for ZeroLeak7 10. ZeroLeak7 Lv 1 6 pts. 11,151

Comments