Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for Keresto 91. Keresto Lv 1 1 pt. 9,948
  2. Avatar for abiogenesis 92. abiogenesis Lv 1 1 pt. 9,924
  3. Avatar for alwen 93. alwen Lv 1 1 pt. 9,922
  4. Avatar for Ikuso 94. Ikuso Lv 1 1 pt. 9,903
  5. Avatar for georged 95. georged Lv 1 1 pt. 9,899
  6. Avatar for JasperD 96. JasperD Lv 1 1 pt. 9,896
  7. Avatar for fishercat 97. fishercat Lv 1 1 pt. 9,879
  8. Avatar for MrZanav 98. MrZanav Lv 1 1 pt. 9,872
  9. Avatar for prooh 99. prooh Lv 1 1 pt. 9,856
  10. Avatar for wosser1 100. wosser1 Lv 1 1 pt. 9,855

Comments