Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for xythus 101. xythus Lv 1 1 pt. 9,854
  2. Avatar for argyrw 102. argyrw Lv 1 1 pt. 9,781
  3. Avatar for pfirth 103. pfirth Lv 1 1 pt. 9,757
  4. Avatar for Savas 104. Savas Lv 1 1 pt. 9,748
  5. Avatar for kevin everington 105. kevin everington Lv 1 1 pt. 9,746
  6. Avatar for zannipietro 106. zannipietro Lv 1 1 pt. 9,739
  7. Avatar for jawz101 107. jawz101 Lv 1 1 pt. 9,663
  8. Avatar for Beany 108. Beany Lv 1 1 pt. 9,628
  9. Avatar for sktbrd341 109. sktbrd341 Lv 1 1 pt. 9,625
  10. Avatar for kangtj06 110. kangtj06 Lv 1 1 pt. 9,620

Comments