Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for pascal ochem 111. pascal ochem Lv 1 1 pt. 9,615
  2. Avatar for Hellena 112. Hellena Lv 1 1 pt. 9,612
  3. Avatar for Dr.Sillem 113. Dr.Sillem Lv 1 1 pt. 9,606
  4. Avatar for zo3xiaJonWeinberg 114. zo3xiaJonWeinberg Lv 1 1 pt. 9,589
  5. Avatar for AlkiP0Ps 115. AlkiP0Ps Lv 1 1 pt. 9,580
  6. Avatar for icecord 116. icecord Lv 1 1 pt. 9,580
  7. Avatar for Deleted player 117. Deleted player 1 pt. 9,567
  8. Avatar for kludbrook 118. kludbrook Lv 1 1 pt. 9,559
  9. Avatar for Mohoernchen 119. Mohoernchen Lv 1 1 pt. 9,549
  10. Avatar for Rathor 120. Rathor Lv 1 1 pt. 9,533

Comments