Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,625
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  5. Avatar for Window Group 15. Window Group 1 pt. 8,631
  1. Avatar for rinze 121. rinze Lv 1 1 pt. 9,483
  2. Avatar for Arne Heessels 122. Arne Heessels Lv 1 1 pt. 9,422
  3. Avatar for aguila5937 123. aguila5937 Lv 1 1 pt. 9,419
  4. Avatar for leodie 124. leodie Lv 1 1 pt. 9,413
  5. Avatar for fabiodavilla 125. fabiodavilla Lv 1 1 pt. 9,405
  6. Avatar for illex 126. illex Lv 1 1 pt. 9,361
  7. Avatar for Catmacdav 127. Catmacdav Lv 1 1 pt. 9,297
  8. Avatar for mvrlin 128. mvrlin Lv 1 1 pt. 9,228
  9. Avatar for winterkonig 129. winterkonig Lv 1 1 pt. 9,145
  10. Avatar for Jenot96 130. Jenot96 Lv 1 1 pt. 9,145

Comments