Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for mirp 11. mirp Lv 1 70 pts. 11,087
  2. Avatar for MicElephant 12. MicElephant Lv 1 67 pts. 11,070
  3. Avatar for TurtleByte 13. TurtleByte Lv 1 64 pts. 11,062
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 62 pts. 11,025
  5. Avatar for guineapig 15. guineapig Lv 1 60 pts. 11,023
  6. Avatar for drjr 16. drjr Lv 1 57 pts. 10,974
  7. Avatar for pauldunn 17. pauldunn Lv 1 55 pts. 10,961
  8. Avatar for robgee 18. robgee Lv 1 53 pts. 10,942
  9. Avatar for johnmitch 19. johnmitch Lv 1 51 pts. 10,934
  10. Avatar for fpc 20. fpc Lv 1 49 pts. 10,917

Comments