Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 30 pts. 10,783
  2. Avatar for fiendish_ghoul 32. fiendish_ghoul Lv 1 29 pts. 10,761
  3. Avatar for maithra 33. maithra Lv 1 28 pts. 10,759
  4. Avatar for John McLeod 34. John McLeod Lv 1 27 pts. 10,749
  5. Avatar for APPAAP 35. APPAAP Lv 1 25 pts. 10,744
  6. Avatar for Formula350 36. Formula350 Lv 1 24 pts. 10,707
  7. Avatar for GuR0 37. GuR0 Lv 1 23 pts. 10,682
  8. Avatar for WBarme1234 38. WBarme1234 Lv 1 22 pts. 10,665
  9. Avatar for jobo0502 39. jobo0502 Lv 1 21 pts. 10,656
  10. Avatar for Tygh 40. Tygh Lv 1 20 pts. 10,650

Comments