Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for Norrjane 41. Norrjane Lv 1 19 pts. 10,638
  2. Avatar for equilibria 42. equilibria Lv 1 18 pts. 10,637
  3. Avatar for Bletchley Park 43. Bletchley Park Lv 1 17 pts. 10,617
  4. Avatar for manu8170 44. manu8170 Lv 1 16 pts. 10,606
  5. Avatar for Aubade01 45. Aubade01 Lv 1 16 pts. 10,597
  6. Avatar for silent gene 46. silent gene Lv 1 15 pts. 10,597
  7. Avatar for nicobul 47. nicobul Lv 1 14 pts. 10,596
  8. Avatar for akaaka 48. akaaka Lv 1 13 pts. 10,581
  9. Avatar for jsfoldingaccount 49. jsfoldingaccount Lv 1 13 pts. 10,577
  10. Avatar for Lotus23 50. Lotus23 Lv 1 12 pts. 10,561

Comments