Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for stomjoh 51. stomjoh Lv 1 11 pts. 10,537
  2. Avatar for NeLikomSheet 52. NeLikomSheet Lv 1 11 pts. 10,525
  3. Avatar for tracybutt 53. tracybutt Lv 1 10 pts. 10,448
  4. Avatar for ProfVince 54. ProfVince Lv 1 10 pts. 10,446
  5. Avatar for Alistair69 55. Alistair69 Lv 1 9 pts. 10,424
  6. Avatar for Jpilkington 56. Jpilkington Lv 1 9 pts. 10,403
  7. Avatar for Vinara 57. Vinara Lv 1 8 pts. 10,399
  8. Avatar for Pawel Tluscik 58. Pawel Tluscik Lv 1 8 pts. 10,371
  9. Avatar for REDing 59. REDing Lv 1 7 pts. 10,362
  10. Avatar for carsonfb 60. carsonfb Lv 1 7 pts. 10,351

Comments