Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for rezaefar 61. rezaefar Lv 1 7 pts. 10,340
  2. Avatar for heather-1 62. heather-1 Lv 1 6 pts. 10,335
  3. Avatar for Hanto 63. Hanto Lv 1 6 pts. 10,304
  4. Avatar for Ashrai 64. Ashrai Lv 1 6 pts. 10,303
  5. Avatar for cjddig 65. cjddig Lv 1 5 pts. 10,290
  6. Avatar for joremen 66. joremen Lv 1 5 pts. 10,272
  7. Avatar for CAN1958 67. CAN1958 Lv 1 5 pts. 10,256
  8. Avatar for kyoota 68. kyoota Lv 1 4 pts. 10,216
  9. Avatar for borattt 69. borattt Lv 1 4 pts. 10,209
  10. Avatar for swiesend 70. swiesend Lv 1 4 pts. 10,196

Comments