Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,896
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,748
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,094
  4. Avatar for Window Group 15. Window Group 1 pt. 8,631

  1. Avatar for infjamc 81. infjamc Lv 1 2 pts. 10,083
  2. Avatar for dahast.de 82. dahast.de Lv 1 2 pts. 10,083
  3. Avatar for Dhalion 83. Dhalion Lv 1 2 pts. 10,078
  4. Avatar for Pikkachurin 84. Pikkachurin Lv 1 2 pts. 10,073
  5. Avatar for 0ut15 85. 0ut15 Lv 1 2 pts. 10,069
  6. Avatar for alcor29 86. alcor29 Lv 1 1 pt. 10,068
  7. Avatar for ShadowTactics 87. ShadowTactics Lv 1 1 pt. 10,066
  8. Avatar for Hellcat6 88. Hellcat6 Lv 1 1 pt. 10,049
  9. Avatar for frostschutz 89. frostschutz Lv 1 1 pt. 9,965
  10. Avatar for OWM3 90. OWM3 Lv 1 1 pt. 9,957

Comments