Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Go Science 100 pts. 11,251
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,246
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 11,203
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 30 pts. 11,175
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,128
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,917
  7. Avatar for Contenders 7. Contenders 7 pts. 10,837
  8. Avatar for Team China 8. Team China 4 pts. 10,362
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 10,066
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,903

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 11,251
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 11,246
  3. Avatar for Enzyme 3. Enzyme Lv 1 94 pts. 11,203
  4. Avatar for grogar7 4. grogar7 Lv 1 90 pts. 11,174
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 87 pts. 11,156
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 84 pts. 11,151
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 81 pts. 11,145
  8. Avatar for Phyx 8. Phyx Lv 1 78 pts. 11,141
  9. Avatar for Galaxie 9. Galaxie Lv 1 75 pts. 11,129
  10. Avatar for aznarog 10. aznarog Lv 1 72 pts. 11,128

Comments