Placeholder image of a protein
Icon representing a puzzle

1931: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
December 16, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,251
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,246
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 11,203
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 30 pts. 11,175
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,128
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,917
  7. Avatar for Contenders 7. Contenders 7 pts. 10,837
  8. Avatar for Team China 8. Team China 4 pts. 10,362
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 10,066
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,903
  1. Avatar for Jakki 71. Jakki Lv 1 4 pts. 10,185
  2. Avatar for Trajan464 72. Trajan464 Lv 1 3 pts. 10,147
  3. Avatar for fisherlr777 73. fisherlr777 Lv 1 3 pts. 10,144
  4. Avatar for Todd6485577 74. Todd6485577 Lv 1 3 pts. 10,135
  5. Avatar for Evica 75. Evica Lv 1 3 pts. 10,119
  6. Avatar for neutralgreen 76. neutralgreen Lv 1 3 pts. 10,107
  7. Avatar for rabamino12358 77. rabamino12358 Lv 1 2 pts. 10,101
  8. Avatar for NPrincipi 78. NPrincipi Lv 1 2 pts. 10,096
  9. Avatar for Czim 79. Czim Lv 1 2 pts. 10,089
  10. Avatar for donuts554 80. donuts554 Lv 1 2 pts. 10,084

Comments