Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,339

  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 11,641
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 73 pts. 11,637
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 52 pts. 11,634
  4. Avatar for Galaxie 4. Galaxie Lv 1 36 pts. 11,634
  5. Avatar for phi16 5. phi16 Lv 1 24 pts. 11,632
  6. Avatar for Dhalion 6. Dhalion Lv 1 16 pts. 11,632
  7. Avatar for silent gene 7. silent gene Lv 1 10 pts. 11,625
  8. Avatar for Czim 8. Czim Lv 1 6 pts. 11,623
  9. Avatar for LociOiling 9. LociOiling Lv 1 4 pts. 11,609
  10. Avatar for pauldunn 10. pauldunn Lv 1 2 pts. 11,593

Comments