Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,339

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 11,635
  2. Avatar for grogar7 2. grogar7 Lv 1 97 pts. 11,612
  3. Avatar for LociOiling 3. LociOiling Lv 1 93 pts. 11,609
  4. Avatar for Enzyme 4. Enzyme Lv 1 89 pts. 11,576
  5. Avatar for pauldunn 5. pauldunn Lv 1 86 pts. 11,522
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 82 pts. 11,502
  7. Avatar for aznarog 7. aznarog Lv 1 79 pts. 11,476
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 76 pts. 11,427
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 73 pts. 11,424
  10. Avatar for Tygh 10. Tygh Lv 1 70 pts. 11,402

Comments