Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,339

  1. Avatar for hiiiiio 111. hiiiiio Lv 1 1 pt. 10,052
  2. Avatar for streamdp 112. streamdp Lv 1 1 pt. 10,018
  3. Avatar for BPS_INGLESE_2020 113. BPS_INGLESE_2020 Lv 1 1 pt. 9,967
  4. Avatar for ume 114. ume Lv 1 1 pt. 9,709
  5. Avatar for malte2008 115. malte2008 Lv 1 1 pt. 9,703
  6. Avatar for beneopp 116. beneopp Lv 1 1 pt. 9,701
  7. Avatar for Yakutsu 117. Yakutsu Lv 1 1 pt. 9,695
  8. Avatar for ice_ink_zwt 118. ice_ink_zwt Lv 1 1 pt. 9,604
  9. Avatar for microversal 119. microversal Lv 1 1 pt. 9,604
  10. Avatar for Kochfumar 120. Kochfumar Lv 1 1 pt. 9,226

Comments