Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,339
  1. Avatar for Wolfie1985 121. Wolfie1985 Lv 1 1 pt. 9,124
  2. Avatar for Knuspy 122. Knuspy Lv 1 1 pt. 9,086
  3. Avatar for Nielsz 123. Nielsz Lv 1 1 pt. 9,086
  4. Avatar for RAH 124. RAH Lv 1 1 pt. 9,086
  5. Avatar for Rustytincan 125. Rustytincan Lv 1 1 pt. 9,086
  6. Avatar for szwisztak222 126. szwisztak222 Lv 1 1 pt. 9,086
  7. Avatar for Bletchley Park 127. Bletchley Park Lv 1 1 pt. 9,086
  8. Avatar for zannipietro 128. zannipietro Lv 1 1 pt. 9,086
  9. Avatar for thio123 129. thio123 Lv 1 1 pt. 9,086

Comments