Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,339

  1. Avatar for Skippysk8s 21. Skippysk8s Lv 1 43 pts. 11,296
  2. Avatar for Phyx 22. Phyx Lv 1 41 pts. 11,294
  3. Avatar for MicElephant 23. MicElephant Lv 1 39 pts. 11,288
  4. Avatar for ucad 24. ucad Lv 1 38 pts. 11,281
  5. Avatar for Deleted player 25. Deleted player 36 pts. 11,276
  6. Avatar for fpc 26. fpc Lv 1 34 pts. 11,272
  7. Avatar for Blipperman 27. Blipperman Lv 1 33 pts. 11,269
  8. Avatar for georg137 28. georg137 Lv 1 31 pts. 11,266
  9. Avatar for johnmitch 29. johnmitch Lv 1 30 pts. 11,264
  10. Avatar for nicobul 30. nicobul Lv 1 28 pts. 11,258

Comments