Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,339
  1. Avatar for heather-1 51. heather-1 Lv 1 9 pts. 10,941
  2. Avatar for stomjoh 52. stomjoh Lv 1 8 pts. 10,939
  3. Avatar for maithra 53. maithra Lv 1 8 pts. 10,939
  4. Avatar for kevin everington 54. kevin everington Lv 1 7 pts. 10,918
  5. Avatar for tracybutt 55. tracybutt Lv 1 7 pts. 10,915
  6. Avatar for alwen 56. alwen Lv 1 7 pts. 10,908
  7. Avatar for kyoota 57. kyoota Lv 1 6 pts. 10,907
  8. Avatar for argyrw 58. argyrw Lv 1 6 pts. 10,889
  9. Avatar for ShadowTactics 59. ShadowTactics Lv 1 5 pts. 10,884
  10. Avatar for cjddig 60. cjddig Lv 1 5 pts. 10,878

Comments