Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,339
  1. Avatar for ProfVince 61. ProfVince Lv 1 5 pts. 10,877
  2. Avatar for jsfoldingaccount 62. jsfoldingaccount Lv 1 4 pts. 10,874
  3. Avatar for Trajan464 63. Trajan464 Lv 1 4 pts. 10,855
  4. Avatar for rezaefar 64. rezaefar Lv 1 4 pts. 10,851
  5. Avatar for sciencewalker 65. sciencewalker Lv 1 4 pts. 10,845
  6. Avatar for CAN1958 66. CAN1958 Lv 1 3 pts. 10,819
  7. Avatar for rabamino12358 67. rabamino12358 Lv 1 3 pts. 10,811
  8. Avatar for borattt 68. borattt Lv 1 3 pts. 10,796
  9. Avatar for Evica 69. Evica Lv 1 3 pts. 10,744
  10. Avatar for Formula350 70. Formula350 Lv 1 3 pts. 10,743

Comments