Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,641
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 11,634
  3. Avatar for Beta Folders 3. Beta Folders 33 pts. 11,609
  4. Avatar for Gargleblasters 4. Gargleblasters 17 pts. 11,593
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 11,476
  6. Avatar for Contenders 6. Contenders 4 pts. 11,297
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,272
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 10,884
  9. Avatar for mm_sannio_2021 9. mm_sannio_2021 1 pt. 10,404
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,378

  1. Avatar for Wolfie1985 121. Wolfie1985 Lv 1 1 pt. 9,124
  2. Avatar for Knuspy 122. Knuspy Lv 1 1 pt. 9,086
  3. Avatar for Nielsz 123. Nielsz Lv 1 1 pt. 9,086
  4. Avatar for szwisztak222 124. szwisztak222 Lv 1 1 pt. 9,086
  5. Avatar for Bletchley Park 125. Bletchley Park Lv 1 1 pt. 9,086
  6. Avatar for zannipietro 126. zannipietro Lv 1 1 pt. 9,086
  7. Avatar for Rustytincan 127. Rustytincan Lv 1 1 pt. 9,086
  8. Avatar for thio123 128. thio123 Lv 1 1 pt. 9,086
  9. Avatar for RAH 129. RAH Lv 1 1 pt. 9,086

Comments