Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,641
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 11,634
  3. Avatar for Beta Folders 3. Beta Folders 33 pts. 11,609
  4. Avatar for Gargleblasters 4. Gargleblasters 17 pts. 11,593
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 11,476
  6. Avatar for Contenders 6. Contenders 4 pts. 11,297
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,272
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 10,884
  9. Avatar for mm_sannio_2021 9. mm_sannio_2021 1 pt. 10,404
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,378

  1. Avatar for jobo0502 11. jobo0502 Lv 1 67 pts. 11,392
  2. Avatar for tyler0911 12. tyler0911 Lv 1 64 pts. 11,391
  3. Avatar for mirp 13. mirp Lv 1 62 pts. 11,383
  4. Avatar for BarrySampson 14. BarrySampson Lv 1 59 pts. 11,360
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 57 pts. 11,359
  6. Avatar for Galaxie 16. Galaxie Lv 1 54 pts. 11,352
  7. Avatar for robgee 17. robgee Lv 1 52 pts. 11,341
  8. Avatar for silent gene 18. silent gene Lv 1 50 pts. 11,324
  9. Avatar for guineapig 19. guineapig Lv 1 47 pts. 11,320
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 45 pts. 11,297

Comments