Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,641
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 11,634
  3. Avatar for Beta Folders 3. Beta Folders 33 pts. 11,609
  4. Avatar for Gargleblasters 4. Gargleblasters 17 pts. 11,593
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 11,476
  6. Avatar for Contenders 6. Contenders 4 pts. 11,297
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,272
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 10,884
  9. Avatar for mm_sannio_2021 9. mm_sannio_2021 1 pt. 10,404
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,378

  1. Avatar for Skippysk8s 21. Skippysk8s Lv 1 43 pts. 11,296
  2. Avatar for Phyx 22. Phyx Lv 1 41 pts. 11,294
  3. Avatar for MicElephant 23. MicElephant Lv 1 39 pts. 11,288
  4. Avatar for ucad 24. ucad Lv 1 38 pts. 11,281
  5. Avatar for Deleted player 25. Deleted player 36 pts. 11,276
  6. Avatar for fpc 26. fpc Lv 1 34 pts. 11,272
  7. Avatar for Blipperman 27. Blipperman Lv 1 33 pts. 11,269
  8. Avatar for georg137 28. georg137 Lv 1 31 pts. 11,266
  9. Avatar for johnmitch 29. johnmitch Lv 1 30 pts. 11,264
  10. Avatar for nicobul 30. nicobul Lv 1 28 pts. 11,258

Comments