Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,641
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 11,634
  3. Avatar for Beta Folders 3. Beta Folders 33 pts. 11,609
  4. Avatar for Gargleblasters 4. Gargleblasters 17 pts. 11,593
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 11,476
  6. Avatar for Contenders 6. Contenders 4 pts. 11,297
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,272
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 10,884
  9. Avatar for mm_sannio_2021 9. mm_sannio_2021 1 pt. 10,404
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,378

  1. Avatar for g_b 31. g_b Lv 1 27 pts. 11,188
  2. Avatar for Alistair69 32. Alistair69 Lv 1 25 pts. 11,177
  3. Avatar for drjr 33. drjr Lv 1 24 pts. 11,176
  4. Avatar for NeLikomSheet 34. NeLikomSheet Lv 1 23 pts. 11,142
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 22 pts. 11,137
  6. Avatar for GuR0 36. GuR0 Lv 1 21 pts. 11,136
  7. Avatar for John McLeod 37. John McLeod Lv 1 20 pts. 11,117
  8. Avatar for phi16 38. phi16 Lv 1 19 pts. 11,104
  9. Avatar for NinjaGreg 39. NinjaGreg Lv 1 18 pts. 11,103
  10. Avatar for carsonfb 40. carsonfb Lv 1 17 pts. 11,090

Comments