Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,641
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 11,634
  3. Avatar for Beta Folders 3. Beta Folders 33 pts. 11,609
  4. Avatar for Gargleblasters 4. Gargleblasters 17 pts. 11,593
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 11,476
  6. Avatar for Contenders 6. Contenders 4 pts. 11,297
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,272
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 10,884
  9. Avatar for mm_sannio_2021 9. mm_sannio_2021 1 pt. 10,404
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,378

  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 16 pts. 11,036
  2. Avatar for OWM3 42. OWM3 Lv 1 15 pts. 11,029
  3. Avatar for akaaka 43. akaaka Lv 1 14 pts. 11,028
  4. Avatar for hansvandenhof 44. hansvandenhof Lv 1 13 pts. 11,017
  5. Avatar for equilibria 45. equilibria Lv 1 13 pts. 11,015
  6. Avatar for Lotus23 46. Lotus23 Lv 1 12 pts. 10,994
  7. Avatar for Threeoak 47. Threeoak Lv 1 11 pts. 10,983
  8. Avatar for Todd6485577 48. Todd6485577 Lv 1 11 pts. 10,982
  9. Avatar for alcor29 49. alcor29 Lv 1 10 pts. 10,966
  10. Avatar for PeterDav 50. PeterDav Lv 1 9 pts. 10,956

Comments