Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,641
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 11,634
  3. Avatar for Beta Folders 3. Beta Folders 33 pts. 11,609
  4. Avatar for Gargleblasters 4. Gargleblasters 17 pts. 11,593
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 11,476
  6. Avatar for Contenders 6. Contenders 4 pts. 11,297
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,272
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 10,884
  9. Avatar for mm_sannio_2021 9. mm_sannio_2021 1 pt. 10,404
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,378

  1. Avatar for Vinara 71. Vinara Lv 1 2 pts. 10,736
  2. Avatar for NPrincipi 72. NPrincipi Lv 1 2 pts. 10,720
  3. Avatar for Ashrai 73. Ashrai Lv 1 2 pts. 10,703
  4. Avatar for donuts554 74. donuts554 Lv 1 2 pts. 10,651
  5. Avatar for heyubob 75. heyubob Lv 1 2 pts. 10,649
  6. Avatar for drumpeter18yrs9yrs 76. drumpeter18yrs9yrs Lv 1 2 pts. 10,635
  7. Avatar for Pawel Tluscik 77. Pawel Tluscik Lv 1 2 pts. 10,633
  8. Avatar for fishercat 78. fishercat Lv 1 2 pts. 10,628
  9. Avatar for MrZanav 79. MrZanav Lv 1 1 pt. 10,626
  10. Avatar for abiogenesis 80. abiogenesis Lv 1 1 pt. 10,616

Comments