Placeholder image of a protein
Icon representing a puzzle

1937: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,094
  2. Avatar for Australia 12. Australia 1 pt. 9,976
  3. Avatar for Deleted group 13. Deleted group pts. 9,819
  4. Avatar for Team China 14. Team China 1 pt. 9,813
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,295

  1. Avatar for JasperD 91. JasperD Lv 1 1 pt. 10,353
  2. Avatar for fishercat 92. fishercat Lv 1 1 pt. 10,317
  3. Avatar for infjamc 93. infjamc Lv 1 1 pt. 10,288
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 10,287
  5. Avatar for dahast.de 95. dahast.de Lv 1 1 pt. 10,258
  6. Avatar for carsonfb 96. carsonfb Lv 1 1 pt. 10,205
  7. Avatar for pfirth 97. pfirth Lv 1 1 pt. 10,193
  8. Avatar for Beany 98. Beany Lv 1 1 pt. 10,150
  9. Avatar for alyssa_d_V2.0 99. alyssa_d_V2.0 Lv 1 1 pt. 10,146
  10. Avatar for ShadowTactics 100. ShadowTactics Lv 1 1 pt. 10,094

Comments