Placeholder image of a protein
Icon representing a puzzle

1937: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,094
  2. Avatar for Australia 12. Australia 1 pt. 9,976
  3. Avatar for Deleted group 13. Deleted group pts. 9,819
  4. Avatar for Team China 14. Team China 1 pt. 9,813
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,295
  1. Avatar for cagdasbb 111. cagdasbb Lv 1 1 pt. 9,874
  2. Avatar for hieu.minh.nguyen 112. hieu.minh.nguyen Lv 1 1 pt. 9,868
  3. Avatar for cravin 113. cravin Lv 1 1 pt. 9,862
  4. Avatar for pascal ochem 114. pascal ochem Lv 1 1 pt. 9,843
  5. Avatar for Sammy3c2b1a0 115. Sammy3c2b1a0 Lv 1 1 pt. 9,828
  6. Avatar for BPS_Carpinelli_2020 116. BPS_Carpinelli_2020 Lv 1 1 pt. 9,819
  7. Avatar for zo3xiaJonWeinberg 117. zo3xiaJonWeinberg Lv 1 1 pt. 9,813
  8. Avatar for zannipietro 118. zannipietro Lv 1 1 pt. 9,812
  9. Avatar for Bletchley Park 119. Bletchley Park Lv 1 1 pt. 9,807
  10. Avatar for Visurex 120. Visurex Lv 1 1 pt. 9,784

Comments