Placeholder image of a protein
Icon representing a puzzle

1937: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,094
  2. Avatar for Australia 12. Australia 1 pt. 9,976
  3. Avatar for Deleted group 13. Deleted group pts. 9,819
  4. Avatar for Team China 14. Team China 1 pt. 9,813
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,295

  1. Avatar for ichwilldiesennamen 11. ichwilldiesennamen Lv 1 70 pts. 11,442
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 67 pts. 11,434
  3. Avatar for silent gene 13. silent gene Lv 1 64 pts. 11,419
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 62 pts. 11,411
  5. Avatar for aznarog 15. aznarog Lv 1 60 pts. 11,404
  6. Avatar for g_b 16. g_b Lv 1 57 pts. 11,397
  7. Avatar for Enzyme 17. Enzyme Lv 1 55 pts. 11,385
  8. Avatar for robgee 18. robgee Lv 1 53 pts. 11,369
  9. Avatar for georg137 19. georg137 Lv 1 51 pts. 11,363
  10. Avatar for drjr 20. drjr Lv 1 49 pts. 11,334

Comments