Placeholder image of a protein
Icon representing a puzzle

1937: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,094
  2. Avatar for Australia 12. Australia 1 pt. 9,976
  3. Avatar for Deleted group 13. Deleted group pts. 9,819
  4. Avatar for Team China 14. Team China 1 pt. 9,813
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,295

  1. Avatar for sciencewalker 71. sciencewalker Lv 1 4 pts. 10,570
  2. Avatar for yunifay 72. yunifay Lv 1 3 pts. 10,565
  3. Avatar for NeedMoreCoffee 73. NeedMoreCoffee Lv 1 3 pts. 10,564
  4. Avatar for Trajan464 74. Trajan464 Lv 1 3 pts. 10,551
  5. Avatar for Jakki 75. Jakki Lv 1 3 pts. 10,550
  6. Avatar for cjddig 76. cjddig Lv 1 3 pts. 10,547
  7. Avatar for hada 77. hada Lv 1 2 pts. 10,539
  8. Avatar for argyrw 78. argyrw Lv 1 2 pts. 10,527
  9. Avatar for tracybutt 79. tracybutt Lv 1 2 pts. 10,519
  10. Avatar for ProfVince 80. ProfVince Lv 1 2 pts. 10,511

Comments