Placeholder image of a protein
Icon representing a puzzle

1937: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,094
  2. Avatar for Australia 12. Australia 1 pt. 9,976
  3. Avatar for Deleted group 13. Deleted group pts. 9,819
  4. Avatar for Team China 14. Team China 1 pt. 9,813
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,295
  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 2 pts. 10,484
  2. Avatar for roman madala 82. roman madala Lv 1 2 pts. 10,478
  3. Avatar for NPrincipi 83. NPrincipi Lv 1 2 pts. 10,435
  4. Avatar for abiogenesis 84. abiogenesis Lv 1 2 pts. 10,431
  5. Avatar for aendgraend 85. aendgraend Lv 1 2 pts. 10,422
  6. Avatar for RockOn 86. RockOn Lv 1 1 pt. 10,410
  7. Avatar for SKSbell 87. SKSbell Lv 1 1 pt. 10,392
  8. Avatar for xythus 88. xythus Lv 1 1 pt. 10,384
  9. Avatar for Pazithi 89. Pazithi Lv 1 1 pt. 10,375
  10. Avatar for Todd6485577 90. Todd6485577 Lv 1 1 pt. 10,366

Comments