Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 11,699
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 11,678
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 94 pts. 11,643
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 91 pts. 11,569
  5. Avatar for mirp 5. mirp Lv 1 88 pts. 11,554
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 85 pts. 11,543
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 82 pts. 11,524
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 79 pts. 11,511
  9. Avatar for Phyx 9. Phyx Lv 1 77 pts. 11,486
  10. Avatar for Deleted player 10. Deleted player 74 pts. 11,467

Comments