Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,702
  2. Avatar for LociOiling 2. LociOiling Lv 1 78 pts. 11,675
  3. Avatar for Deleted player 3. Deleted player 60 pts. 11,669
  4. Avatar for robgee 4. robgee Lv 1 45 pts. 11,633
  5. Avatar for silent gene 5. silent gene Lv 1 33 pts. 11,616
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 24 pts. 11,616
  7. Avatar for kyoota 7. kyoota Lv 1 17 pts. 11,613
  8. Avatar for mirp 8. mirp Lv 1 12 pts. 11,613
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 8 pts. 11,612
  10. Avatar for hansvandenhof 10. hansvandenhof Lv 1 6 pts. 11,594

Comments