Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,702
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 11,678
  3. Avatar for Go Science 3. Go Science 49 pts. 11,643
  4. Avatar for Contenders 4. Contenders 33 pts. 11,524
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,511
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 11,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,340
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,534
  9. Avatar for SETI.Germany 9. SETI.Germany 3 pts. 10,494
  10. Avatar for Team China 10. Team China 2 pts. 10,464

  1. Avatar for JSon 91. JSon Lv 1 2 pts. 10,330
  2. Avatar for Hellcat6 92. Hellcat6 Lv 1 1 pt. 10,317
  3. Avatar for wosser1 93. wosser1 Lv 1 1 pt. 10,304
  4. Avatar for JasperD 94. JasperD Lv 1 1 pt. 10,281
  5. Avatar for Trajan464 95. Trajan464 Lv 1 1 pt. 10,265
  6. Avatar for rinze 96. rinze Lv 1 1 pt. 10,259
  7. Avatar for hada 97. hada Lv 1 1 pt. 10,247
  8. Avatar for fearjuan 98. fearjuan Lv 1 1 pt. 10,235
  9. Avatar for Vinara 99. Vinara Lv 1 1 pt. 10,220
  10. Avatar for MrZanav 100. MrZanav Lv 1 1 pt. 10,184

Comments