Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,054
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 9,827
  3. Avatar for Window Group 13. Window Group 1 pt. 8,415
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,370
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,895
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 97 pts. 11,795
  3. Avatar for grogar7 3. grogar7 Lv 1 93 pts. 11,780
  4. Avatar for mirp 4. mirp Lv 1 89 pts. 11,495
  5. Avatar for Enzyme 5. Enzyme Lv 1 86 pts. 11,441
  6. Avatar for Galaxie 6. Galaxie Lv 1 83 pts. 11,418
  7. Avatar for Aubade01 7. Aubade01 Lv 1 79 pts. 11,365
  8. Avatar for johnmitch 8. johnmitch Lv 1 76 pts. 11,360
  9. Avatar for MicElephant 9. MicElephant Lv 1 73 pts. 11,358
  10. Avatar for Phyx 10. Phyx Lv 1 70 pts. 11,356

Comments

WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?